Recombinant Rat Olfactory receptor 1(Olfr1)

Code CSB-CF300281RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P70526
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence MTERNQTVISQFLLLGLPIPPEHQHVFYALFLSMYLTTVLGNLIIIILILLDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPYAGCLSQIYFFLFFGDLGNFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDNVIPHFFCD MSALLKLACSDTRVNEVVIFIVVSLFLVLPFALIIMSYVRIVSSILKVPSSQGIYKAFST CGSHLSVVSLFYGTVIGLYLCPSSNNSTVKETVMSLMYTVVTPMLNPFIYSLRNRDIKGA MERIFCKRKIQLNL
Source in vitro E.coli expression system
Gene Names Olfr1
Protein Names Recommended name: Olfactory receptor 1 Alternative name(s): Olfactory receptor 1469 Olfactory receptor HGL-SP1 Olfactory receptor OR5 Olfactory receptor-like protein I54
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor. Activated by a lily-derived aldehyde as well as other odorants. May signal through an inositol 1,4,5-trisphosphate (IP3) second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Olfactory epithelium.
Database Links

KEGG: rno:100909534

UniGene: Rn.113464

Related Products

Olfr1 Proteins

Olfr1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.