Recombinant Rat Olfactory receptor-like protein I9

Code CSB-CF338505RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P23272
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence MTRRNQTAISQFFLLGLPFPPEYQHLFYALFLAMYLTTLLGNLIIIILILLDSHLHTPMY LFLSNLSFADLCFSSVTMPKLLQNMQSQVPSIPYAGCLAQIYFFLFFGDLGNFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCEDSVIPHYFCD MSTLLKVACSDTHDNELAIFILGGPIVVLPFLLIIVSYARIVSSIFKVPSSQSIHKAFST CGSHLSVVSLFYGTVIGLYLCPSANNSTVKETVMSLMYTMVTPMLNPFIYSLRNRDIKDA LEKIMCKKQIPSFL
Source in vitro E.coli expression system
Protein Names Recommended name: Olfactory receptor-like protein I9
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Olfactory epithelium.
Database Links

STRING: 10116.ENSRNOP00000067461

UniGene: Rn.129823

Related Products

Proteins

Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.