Recombinant Rat Potassium channel subfamily K member 12(Kcnk12)

Code CSB-CF872134RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9ERS1
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MSSRSPRPPPRRCRRRLPRPSCCCCCCRRSHLNEDTGRFVLLAALIGLYLVAGATVFSAL ESPGEAEARARWGATLRNFSAAHGVAEPELRAFLRHYEAALAAGVRADALRPRWDFPGAF YFVGTVVSTIGFGMTTPATVGGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACR ERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYHVLLILGLFAVLLACCASAMYTSVEG WDYVDSLYFCFVTFSTIGFGDLVSSQHAAYRNQGLYRLGNFLFILLGVCCIYSLFNVISI LIKQVLNWMLRKLSCRCCTRCCPAPGAPLSRRNAITPGSRLRRRLAALGTDPAARDSDAE GRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMN NRLAETSASR
Source in vitro E.coli expression system
Gene Names Kcnk12
Protein Names Recommended name: Potassium channel subfamily K member 12 Alternative name(s): Tandem pore domain halothane-inhibited potassium channel 2 Short name= THIK-2
Expression Region 1-430
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable potassium channel subunit. No channel activity observed in heterologous systems. May need to associate with another protein to form a functional channel.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Highly expressed in most brain regions. Also expressed in other tissues such as lung, kidney, liver, stomach and spleen.
Database Links

KEGG: rno:64119

STRING: 10116.ENSRNOP00000021570

UniGene: Rn.64577

Related Products

Kcnk12 Proteins

Kcnk12 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.