Recombinant Rat Potassium channel subfamily K member 13(Kcnk13)

Code CSB-CF887663RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9ERS0
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MAGRGCSCSPGHLNEDNARFLLLAGLILLYLLGGAAVFSALELAQELQAKQRWEERLANF SRGHNLSREELRGFLRHYEEATKAGIRMDSVRPRWDFTGAFYFVGTVVTTIGFGMTTPAT TGGKVFLIFYGLIGCASTILFFNLFLERLITVIAYVMRTCHHQQLRRRGTVARDNRKAPR KGEADSLAGWKPSVYYVMLILCLASVAISCGASALYTTMEGWSYFDSVYFCFVASSTIGF GDLVSSQNAQYENEGLYRFVNFFFILMGVCCIYSMFNVISILIKQTVNWILRKLDSGCFP QCQRGLLRSRRNVVMPGNIRNRCNISIETDGVMESDTDGRRLSGEMISMKDTNKVSLAIL QKQLSEMANGGPHQTSTSSRDDEFSGGVGAFAVMNNRLAETSGDR
Source in vitro E.coli expression system
Gene Names Kcnk13
Protein Names Recommended name: Potassium channel subfamily K member 13 Alternative name(s): Tandem pore domain halothane-inhibited potassium channel 1 Short name= THIK-1
Expression Region 1-405
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potassium channel displaying weak inward rectification in symmetrical K(+) solution.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Ubiquitous. In brain expression is rather low and restricted to the olfactory bulb and tubercle, to the ventromedial hypothalamic nucleus, lateral septal nucleus dorsal, lateral mammillary nucleus, lateral parabrachial nuclei, reticular nucleus and reunio
Database Links

KEGG: rno:64120

STRING: 10116.ENSRNOP00000067310

UniGene: Rn.53793

Related Products

Kcnk13 Proteins

Kcnk13 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.