Recombinant Rat Potassium channel subfamily K member 18(Kcnk18)

Code CSB-CF747508RA
Size Pls inquire other sizes
Source in vitro E.coli expression system

Product Details

Target Names Kcnk18
Uniprot No. Q6Q1P3
Species Rattus norvegicus (Rat)
Expression Region 1-405
Target Protein Sequence MEAEEPPEARRRCPEALGKASGCCPEAPGKARGCCPEALGKLLPGLCFLCCLVTYALVGA ALFSAVEGRPDPEAEENPELKKFLDKLCNILKCNLTVVEGSRKDLCEHLQQLKPQWFKAP EDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILAAI LSRAYSRFQALLCLPRDISKWRPLLLCRKQTDSKPADEAIPQIVIDAGADELLDPQPSRE PASPSCNVELFERLVAREKQNELQPPMRPVERSNSCPELVLGRLSCSILSNLDEVGQQVE RLDIPLPVIALVIFAYISCAAAILPFWETDLGFEDAFYFCFVTLTTIGFGDIVLVHPHFF LFFSIYIIVGMEILFIAFKLMQNRLLHTYKTLMLFVCQREVSLPC
Protein Length full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.
Still Have Questions? Start a Chat

Target Data

Function Outward rectifying potassium channel. Produces rapidly activating outward rectifier K(+) currents. May function as background potassium channel that sets the resting membrane potential. Channel activity is directly activated by calcium signal. Activated by the G(q)-protein coupled receptor pathway. The calcium signal robustly activates the channel via calcineurin, whereas the anchoring of 14-3-3/YWHAH interferes with the return of the current to the resting state after activation. Inhibited also by arachidonic acid and other naturally occurring unsaturated free fatty acids. Channel activity is also enhanced by volatile anesthetics, such as isoflurane. Appears to be the primary target of hydroxy-alpha-sanshool, an ingredient of Schezuan pepper. May be involved in the somatosensory function with special respect to pain sensation (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Database Links

KEGG: rno:445371

STRING: 10116.ENSRNOP00000039866

UniGene: Rn.124394

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.