Recombinant Rat Potassium channel subfamily K member 18(Kcnk18)

Code CSB-CF747508RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6Q1P3
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MEAEEPPEARRRCPEALGKASGCCPEAPGKARGCCPEALGKLLPGLCFLCCLVTYALVGA ALFSAVEGRPDPEAEENPELKKFLDKLCNILKCNLTVVEGSRKDLCEHLQQLKPQWFKAP EDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILAAI LSRAYSRFQALLCLPRDISKWRPLLLCRKQTDSKPADEAIPQIVIDAGADELLDPQPSRE PASPSCNVELFERLVAREKQNELQPPMRPVERSNSCPELVLGRLSCSILSNLDEVGQQVE RLDIPLPVIALVIFAYISCAAAILPFWETDLGFEDAFYFCFVTLTTIGFGDIVLVHPHFF LFFSIYIIVGMEILFIAFKLMQNRLLHTYKTLMLFVCQREVSLPC
Source in vitro E.coli expression system
Gene Names Kcnk18
Protein Names Recommended name: Potassium channel subfamily K member 18 Alternative name(s): Tresk-2 Two-pore-domain potassium channel TRESK
Expression Region 1-405
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Outward rectifying potassium channel. Produces rapidly activating outward rectifier K(+) currents. May function as background potassium channel that sets the resting membrane potential. Channel activity is directly activated by calcium signal. Activated by the G(q)-protein coupled receptor pathway. The calcium signal robustly activates the channel via calcineurin, whereas the anchoring of 14-3-3/YWHAH interferes with the return of the current to the resting state after activation. Inhibited also by arachidonic acid and other naturally occurring unsaturated free fatty acids. Channel activity is also enhanced by volatile anesthetics, such as isoflurane. Appears to be the primary target of hydroxy-alpha-sanshool, an ingredient of Schezuan pepper. May be involved in the somatosensory function with special respect to pain sensation (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Database Links

KEGG: rno:445371

STRING: 10116.ENSRNOP00000039866

UniGene: Rn.124394

Related Products

Kcnk18 Proteins

Kcnk18 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.