Recombinant Rat Potassium channel subfamily K member 9(Kcnk9)

Code CSB-CF861699RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9ES08
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MKRQNVRTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLKAEEVRLRGKYNISSDDYQ QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCLGAAAFSQ CEDWSFFHAYYYCFITLTTIGFGDFVALQSKGALQRKPFYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNTDEDLLEGEVAQILAGNPRRVVVRVPQSRKRHHPMYFLRKYGRTLCYLCF PGANWGDDDDDDDDAVENVVVTTPVPPAVAAAAAAATPGPSTRNVRATVHSVSCRVEEIP PDVLRNTYFRSPFGAIPPGMHTCGENHRLHIRRKSI
Source in vitro E.coli expression system
Gene Names Kcnk9
Protein Names Recommended name: Potassium channel subfamily K member 9 Alternative name(s): Acid-sensitive potassium channel protein TASK-3 TWIK-related acid-sensitive K(+) channel 3 Two pore potassium channel KT3.2 Short name= Two pore K(+) chan
Expression Region 1-396
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function pH-dependent, voltage-insensitive, background potassium channel protein.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Highly expressed in the CNS and at lower levels in the colon, kidney, liver, lung, spleen, stomach and skeletal muscle. The highest expression was found in the olfactory nuclei, piriform cortex, cerebellum, antedorsal thalmic nucleus, pontine nucleus, dor
Database Links

KEGG: rno:84429

STRING: 10116.ENSRNOP00000012408

UniGene: Rn.48796

Related Products

Kcnk9 Proteins

Kcnk9 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.