Recombinant Rat Potassium channel subfamily K member 9 (Kcnk9)

Code CSB-CF861699RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Kcnk9
Uniprot No.
Alternative Names
Kcnk9; Task3; Potassium channel subfamily K member 9; Acid-sensitive potassium channel protein TASK-3; TWIK-related acid-sensitive K(+ channel 3; Two pore potassium channel KT3.2; Two pore K(+ channel KT3.2
Species
Rattus norvegicus (Rat)
Expression Region
1-396
Target Protein Sequence
MKRQNVRTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLKAEEVRLRGKYNISSDDYQ QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCLGAAAFSQ CEDWSFFHAYYYCFITLTTIGFGDFVALQSKGALQRKPFYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNTDEDLLEGEVAQILAGNPRRVVVRVPQSRKRHHPMYFLRKYGRTLCYLCF PGANWGDDDDDDDDAVENVVVTTPVPPAVAAAAAAATPGPSTRNVRATVHSVSCRVEEIP PDVLRNTYFRSPFGAIPPGMHTCGENHRLHIRRKSI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
pH-dependent, voltage-insensitive, background potassium channel protein.
Gene References into Functions
  1. results demonstrate that neurotensin (NT) transiently increased the neuronal excitability of dentate gyrus granule cells (GCs) by inhibiting TASK-3 channels; NT-mediated increases in neuronal excitability facilitate long-term potentiation at the perforant path-GC synapses PMID: 25405940
  2. Hydroxy-alpha sanshool evokes colonic motility via blockage of the neural KCNK9 channel in the colonic myenteric plexus. PMID: 25634809
  3. the entire rat brain was immunocytochemically analyzed for expression of TASK-3 protein. PMID: 24077856
  4. Expression of the TASK-3 protein in motor systems of the rat central nervous system was examined. PMID: 22011781
  5. Results suggest that expression of TASK-2 and TASK-3 (but not TASK-1) undergoes age-related changes in dorsal root ganglion (DRG) neurons; TASK-2 and TASK-3 are likely to contribute to resting membrane potential in DRG neurons in neonates and adults. PMID: 22017174
  6. TASK-3 immunoreactivity was observed in neurons of the rat hippocampus PMID: 21710317
  7. Immunofluorescence double-labeling experiments with appropriate marker enzymes confirmed the expression of TASK-3 in cholinergic, serotoninergic, and noradrenergic neurons. PMID: 21082237
  8. mRNA expression of TASK3 was significantly higher in SHR than in WKY carotid bodies before hypertension developed. PMID: 20019330
  9. TASK-3 dominates the resting potassium conductance of zona glomerulosa cells PMID: 11875121
  10. Task3 distribution in the carotid body is limited to type I cells and vascular smooth muscle cells. PMID: 12231257
  11. TASK-3 mRNA is present in ventrolateral medulla neurons that regulate respiration or circulation (C1 adrenergic neurons). TASK channels are expressed by respiratory cells with putative rhythmogenic function and by premotor and motor neurons. PMID: 14519375
  12. Localization of the Task-3 protein was studied. PMID: 14574589
  13. role for TASK-3 in modulating cerebral synaptic transmission and responses to central nervous system active drugs PMID: 15178438
  14. first mutation found in a genetic model of absence epilepsy (GAERS), identified at the genomic level in the KCNK9 gene; a trinucleotide insertion, which expands a polyalanine region in the intracellular C-terminal tail of the TASK3 channel PMID: 15781965
  15. TASK3 and HCN2 channels stabilize the membrane potential by a mutual functional interactions. PMID: 16760342
  16. TASK-3 transcription is regulated by membrane potential via the calcineurin pathway PMID: 16864570
  17. Characterization of the 5' and 3' untranslated regions of TASK-3 gene involved in gene regulation. PMID: 16925981
  18. TASK-3-like background K(+) currents contribute to establishing membrane potential in striatal cholinergic interneurons PMID: 17167057
  19. Thus, neuronal excitability of PnC giant neurones in vivo is most likely increased by serotonergic projections via the K(2)P channel TASK-3. PMID: 18691333

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity
Highly expressed in the CNS and at lower levels in the colon, kidney, liver, lung, spleen, stomach and skeletal muscle. The highest expression was found in the olfactory nuclei, piriform cortex, cerebellum, antedorsal thalmic nucleus, pontine nucleus, dor
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X