Recombinant Rat Potassium voltage-gated channel subfamily D member 3 (Kcnd3)

Code CSB-CF720324RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Kcnd3
Uniprot No.
Alternative Names
Kcnd3; Potassium voltage-gated channel subfamily D member 3; Voltage-gated potassium channel subunit Kv4.3
Species
Rattus norvegicus (Rat)
Expression Region
1-655
Target Protein Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF YGILPEIIGDCCYEEYKDRKRENAERLMDDNESENNQESMPSLSFRQTMWRAFENPHTST LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLL HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHS GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG LRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSITSNVVKVSVL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
Gene References into Functions
  1. down-regulation of Kv4.3 channels mediating A-type K(+) (IA) currents currents in nociceptive V2 trigeminal neurons is an underlying mechanism of oxaliplatin-induced orofacial neuropathic pain. PMID: 29313436
  2. This study demonstated that that Kv4.3 is involved in vibration-induced muscle pain and explored whether changes in Kv4.3 expression in nociceptors contributes to the mechanical hyperalgesia in a model of hand-arm vibration syndrome in the rat. PMID: 26721612
  3. These results indicate that Kv4.3 is likely the target of discrepin and highlight the importance of the basic residue K13, located in the alpha-helix of the toxin, for current blockage. PMID: 24845726
  4. This study demonistrared that the expression and function of Kv4.3 channels in neurons of the rat bed nucleus of the stria terminalis. PMID: 24037673
  5. cardiomyocyte endosomes control channel kv4.3 mRNA expression by mediating delayed oxidative CamKII-p38K signaling. PMID: 22266351
  6. Immunocytochemistry indicated that protein expression for Kv4.3 increased between 1 wk and 4-5 wk of age. PMID: 21451062
  7. Kv4.3 is the major molecular component in GnRH neurons, and the expression of Kv4.3 changes significantly during the rat estrous cycle PMID: 20861393
  8. Downregulated Kv4.3 expression in the RVLM as a potential mechanism for sympathoexcitation in rats with chronic heart failure. PMID: 20044444
  9. Kv4.3 in migrating Purkinje cells with mediolateral compartmentalization. Purkinje cells no longer expressed Kv4.3 after completing migration. Kv4.3 may play important role in development of cerebellum and in mature cerebellum. PMID: 12911756
  10. Data suggest that the angiotensin receptor type 1 provides its internalization molecular scaffold to Kv4.3 and in this way regulates the cell surface representation of the ion channel. PMID: 15342638
  11. data suggest that Kv4.2 subunits could be involved in pain modulation. PMID: 16176357
  12. X-ray crystallographic and small-angle X-ray scattering data that show that the KChIP1-Kv4.3 N-terminal cytoplasmic domain complex is a cross-shaped octamer bearing two principal interaction sites. PMID: 17057713
  13. Novel function of Kv4.3-mediated A-type K+ currents in generation of intrinsic membrane potential oscillations in specific subpopulations of interneurons that may participate in hippocampal theta-related rhythmic activity. PMID: 17314290
  14. In a neuropathic pain model, the protein level of Kv4.3 is greatly reduced in dorsal root ganglion neurons. PMID: 17855600
  15. Kv4.3 and KChIP1 component subunits of A-type channels are co-localized in the soma and dendrites of a large number of GABAergic hippocampal interneurons PMID: 18495361
  16. Data suggest that the expression of Kv4.3 channels in the failing heart is redox-regulated by the thioredoxin system. PMID: 18515646
  17. Ang II acts via AT(1) receptors, NADPH oxidase and p38 MAP kinase to upregulate AUF1, which in turn binds to an ARE in the Kv4.3 3'UTR to destabilize the channel mRNA PMID: 18789946
  18. TRalpha1 and TRbeta1 exhibit distinct effects on KCND3 transactivation in cardiomyocytes, with TRalpha1 enhancing and TRbeta1 suppressing KCND3 transcription. PMID: 19171649

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane, sarcolemma; Multi-pass membrane protein. Cell projection, dendrite.
Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.3/KCND3 sub-subfamily
Tissue Specificity
Highly expressed in brain, in particular in the retrosplenial cortex, medial habenula, anterior thalamus, hippocampus, cerebellum and lateral geniculate and superior colliculus. Highly expressed in heart atrium (at protein level) and throughout the ventri
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1