Recombinant Rat Potassium voltage-gated channel subfamily E member 1(Kcne1)

Code CSB-CF012025RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P15383
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence MALSNSTTVLPFLASLWQETDEPGGNMSADLARRSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKALFQARVLESFRACYVIENQAAVEQPATHLPELKPLS
Source in vitro E.coli expression system
Gene Names Kcne1
Protein Names Recommended name: Potassium voltage-gated channel subfamily E member 1 Alternative name(s): Delayed rectifier potassium channel subunit IsK IKs producing slow voltage-gated potassium channel subunit beta Mink Minimal potassium channel
Expression Region 1-130
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1
Subcellular Location Cell membrane, Single-pass type I membrane protein, Apical cell membrane, Membrane raft
Protein Families Potassium channel KCNE family
Tissue Specificity Expressed in the heart (PubMed:2183220, PubMed:19219384). Expressed in kidney (PubMed:2344412). Expressed in estrogen-induced uterus (PubMed:2344412).
Database Links

KEGG: rno:25471

STRING: 10116.ENSRNOP00000002717

UniGene: Rn.9734

Related Products

Kcne1 Proteins

Kcne1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.