Recombinant Rat Presenilins-associated rhomboid-like protein, mitochondrial(Parl)

Code CSB-CF664163RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3B8P0
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence FRKAPRKVEPRRSDTGSSGEAYKRSALIPPLEETVFYPSPYPVRTLLKPFFFTVGFTGCA FGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGNLRKEINKWWNSLSDGQRTVTGI IAANALVFCLWRVPSLHRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSF STSIVNILGQEQFVAVYLSAGVISNFVSYVCKVATGRYGPSLGASGAIMTVLAAVCTKIP EGRLAIIFLPVFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYITYGHEL IWKNREPLVKIWHEIRTNGPKKGGGSK
Source in vitro E.coli expression system
Gene Names Parl
Protein Names Recommended name: Presenilins-associated rhomboid-like protein, mitochondrial EC= 3.4.21.105 Alternative name(s): Mitochondrial intramembrane-cleaving protease PARL Cleaved into the following chain: 1. P-beta Short name= 2. Pbeta
Expression Region 51-377
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the control of apoptosis during postnatal growth. Essential for proteolytic processing of an antiapoptotic form of OPA1 which prevents the release of mitochondrial cytochrome c in response to intrinsic apoptoptic signals (By similarity).
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: P-beta: Nucleus
Protein Families Peptidase S54 family
Database Links

KEGG: rno:287979

UniGene: Rn.7053

Related Products

Parl Proteins

Parl Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.