Recombinant Rat Rhomboid domain-containing protein 3(Rhbdd3)

Code CSB-CF727056RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q642B3
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MHAWDPPASLSRALPLASSVLMLLLSCLWLLGAGPSLRLAPELLTEPWQVHRLLTHALGH TALPGLLLSLLLLPTLGWWQECHLGTLRFLHNSAVLALATGLLAVLLAGLGLSSAAGGCG YMPVHLAMLAGQSYYPGWPQRTLPPWLLPWLLLALTLLLSSEPPFLQLLCGLLAGLAYAA GAFRWLELSERRLQVLQEGVLCRTLAGCWPLKLLPTPGSLGELPVTYPAGVRPATPRPPY LASSSSWPHTDGFAQLPPGLGPGQLTWKNSERDLDWAGPSFASATPMWAALDEQMLQEGI QASLLDVSVQGSQNTLWSPKPSVSSLRLQQLQHMGFPTEQAAVALAATGRVEGAVSLLVE GLVDTEALVTEERSGPAHCKDTGVS
Source in vitro E.coli expression system
Gene Names Rhbdd3
Protein Names Recommended name: Rhomboid domain-containing protein 3
Expression Region 1-385
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Database Links

KEGG: rno:289753

STRING: 10116.ENSRNOP00000032424

UniGene: Rn.9606

Related Products

Rhbdd3 Proteins

Rhbdd3 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.