Recombinant Rat Rod outer segment membrane protein 1(Rom1)

Code CSB-CF719009RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5PPM7
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MAPVLPVVLPLQPRIRLAQGTWLLSWLLALAGGLTLLCSGHLLVQLWHLGTFLAPSCSFP ALPQTALAAGAVALGTGLGGAGASRASLDAAQYPPWRGVLTPLLVVGTAAGGGLLTLGLG LALALPVSLHQGLEEGLQAALAHYKDTEVPGHCQAKRLMDELQLRYHCCGRHGYKDWFGV QWVSSRYLDPNDQDVVDRIQSNVEGLYLIDGVPFSCCNPHSPRPCLQSQLSDPYAHPLFD PRQPNLNLWAQGCHEVLVGHLQGLSGTLGSILAVTLLLQVLVLLGLRYLQTALEGLGGVI DGEGETQGYLLPGGLKDILQTAWLQGGLAHKPAPEEAPPDEEPPKEVLAEA
Source in vitro E.coli expression system
Gene Names Rom1
Protein Names Recommended name: Rod outer segment membrane protein 1 Short name= ROSP1
Expression Region 1-351
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. It is essential for disk morphogenesis (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families PRPH2/ROM1 family
Tissue Specificity Retina (photoreceptor). In rim region of ROS (rod outer segment) disks.
Database Links

KEGG: rno:309201

STRING: 10116.ENSRNOP00000026897

UniGene: Rn.145021

Related Products

Rom1 Proteins

Rom1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.