Recombinant Rat Sugar transporter SWEET1(Slc50a1)

Code CSB-CF514254RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. D3ZH22
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MEAGGVADSFLSSACVLFTLGMFSTGLSDLRHMQRTRSVDNIQFLPFLTTDVNNLGWLSY GVLKGDGTLIIVNTVGAVLQTLYILAYLHYSPQKHAVLLQTATLLAVLLLGYGYFWLLVP DLETRLQQLGLFCSVFTISMYLSPLADLAKIIQTKSTQRLSFSLTIATLLSSTSWSIYGF RLKDPYITVPNLPGILTGFIRLVLFYKYPPEQDTKYRLLQT
Source in vitro E.coli expression system
Gene Names Slc50a1
Protein Names Recommended name: Sugar transporter SWEET1 Alternative name(s): RAG1-activating protein 1 Solute carrier family 50 member 1
Expression Region 1-221
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1 (By similarity).
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families SWEET sugar transporter family
Database Links

KEGG: rno:295245

STRING: 10116.ENSRNOP00000027878

UniGene: Rn.823

Related Products

Slc50a1 Proteins

Slc50a1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.