Recombinant Rat Taste receptor type 2 member 102(Tas2r102)

Code CSB-CF734567RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q675C0
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MEPVIYSFATLLIHVEFIFGNLSNGFIVLSNFWDWVIKRKLSTIDKILLTLAISRITLIW EIYTWFTSVYGPSSFAIGMKLQILYFTWILSSHFSLWFATALSIFYLLRIANCSWKIFLY LKWRLKQVIVGMLLASLVFLPGILTQRTLEERPYRYGGNTSEDSMETDFARFTELILFNL TIFSVIPFSLASISFLLLIFSLWKHLRKMQLSSRGHGDPSTKAHTNALRIMVSFLLLYSI YFLSLLLSWIAQKHHSKLVDIIGIITGLMYPSAHSFILILGNSKLMQTSLWILSHLRCRL KGENILNPSGNQVTSCYIFCIANKSVS
Source in vitro E.coli expression system
Gene Names Tas2r102
Protein Names Recommended name: Taste receptor type 2 member 102 Short name= T2R102 Alternative name(s): Taste receptor type 2 member 37 Short name= T2R37
Expression Region 1-327
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative taste receptor which may play a role in the perception of bitterness.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor T2R family

Related Products

Tas2r102 Proteins

Tas2r102 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.