Recombinant Rat Vesicle-associated membrane protein 3(Vamp3)

Code CSB-CF025782RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P63025
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGISVLVIIVIIIIVWCVS
Source in vitro E.coli expression system
Gene Names Vamp3
Protein Names Recommended name: Vesicle-associated membrane protein 3 Short name= VAMP-3 Alternative name(s): Cellubrevin Short name= CEB Synaptobrevin-3
Expression Region 1-103
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.
Subcellular Location Membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome
Protein Families Synaptobrevin family
Tissue Specificity Ubiquitous.
Database Links

KEGG: rno:29528

STRING: 10116.ENSRNOP00000048364

UniGene: Rn.219999

Related Products

Vamp3 Proteins

Vamp3 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.