Recombinant Rat Vomeronasal type-1 receptor A12(V1ra12)

Code CSB-CF689282RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5J3L6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence MSEFPFFSPQPLFSYMMNKNSRVHTDSNIRNTFFTEIGIGILANSFLLLFHIFKFIRGQR SRLTDLPIGLLSLIHLLMLLMGAFIAIDIFISWRGWDDIICKFLVYLYRSFRGLSLCTTC MLSVLQAITLSPRSSCLAKFKHKSPHHVSCAIISLSILYMFISSHLLVSINATPNLTTNN FMQVTQSCYIIPLSYLMQSMFSTLLAIRDISLISLMVLSTCYMVVLLCRHRNQIQHLQGT NLSPKASPEQRATQTILMLMTFFVLMSIFDSIVSCSRTMYLNDPTSYYIQIFVVYIYATV SPFVFMSTEKHIVNFLKSMCVRVKNV
Source in vitro E.coli expression system
Gene Names Vom1r100
Protein Names Recommended name: Vomeronasal type-1 receptor A12 Alternative name(s): Pheromone receptor VN3 Vomeronasal receptor 3
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative pheromone receptor implicated in the regulation of social as well as reproductive behavior.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in 1-4% of neurons of the vomeronasal organ. Only one pheromone receptor gene may be expressed in a particular neuron. Not expressed in the main olfactory epithelium.
Database Links

KEGG: rno:297439

UniGene: Rn.10141

Related Products

Vom1r100 Proteins

Vom1r100 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.