Recombinant Rat cytomegalovirus G-protein coupled receptor homolog R33

Code CSB-CF517066RJT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O12000
Storage Buffer Tris-based buffer,50% glycerol
Species Rat cytomegalovirus (strain Maastricht)
Sequence MDVLLGTEELEDELHQLHFNYTCVPSLGLSVARDAETAVNFLIVLVGGPMNFLVLATQML SNRSYSVSTPTLYMTNLYLANLLTVATLPFLMLSNRGLVGSSPEGCKIAALAYYATCTAG FATLMLIAINRYRVIHQRTRSGAGSKRQTYAVLAVTWLASLMCASPAPLYATVMAHDSAD ALAFETCIIYFSYDQVKTVLATFKILITMIWGITPVVMMSWFYVFFYRRLKLTSYRRRSQ TLTFVTTLMLSFLVVQTPFVAIMSYDSYGVLNWPINCDTINKRDAVSMLARVVPNFHCLL NPVLYAFLGRDFNKRFILCISGKLFSRRRALRERAGLGAQIVGPVCALPSKTVTLSEETR DLSQEIRRLRALGRPPPPPPPPPPPNC
Source in vitro E.coli expression system
Protein Names Recommended name: G-protein coupled receptor homolog R33
Expression Region 1-387
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in vivo, in particular in the dissemination to or replication in the salivary gland.
Subcellular Location Host cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: vg:940282

Related Products

Proteins

Proteins for Rat cytomegalovirus (strain Maastricht)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.