Recombinant Rhizobium meliloti Putative zinc metalloprotease R01501(R01501)

Code CSB-CF835851RKU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q92Q49
Storage Buffer Tris-based buffer,50% glycerol
Species Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Sequence MSLLLDNLQYTIPTFLFLLTLLVFVHEMGHYLVGRWSGIRILAFSVGFGPELFGWTDRHG TRWKFCAVPLGGYVKFFGDEDAASTPDYRRLETIAPEERGRTFLGAKLWKRAATVAAGPI ANFLLAIAIFAVLFSIYGRAVADPVVAFVAPDSAAEKAGVLPGDRLLSIDGKPIATFDDV RRYVSVRPELPITVRIEREGAAIDLPMVPQRTESVDPLGNKMEEGKIGIGTNQEAGNFRV ETYGPLEAVGQGALQSWRIVTGTLDYLSNLFVGRMSADQVGGPIRIAQMSGQMAKLGIAE VLNFAAVLSVSIGLLNLMPVPVLDGGHLMFYAVEALRGRPVGPAAQDLAFRIGFAMVLML TVFAAWNDINWLFG
Source in vitro E.coli expression system
Gene Names R01501
Protein Names Recommended name: Putative zinc metalloprotease R01501 EC= 3.4.24.-
Expression Region 1-374
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Peptidase M50B family
Database Links

KEGG: sme:SMc02095

STRING: 266834.SMc02095

Related Products

R01501 Proteins

R01501 Proteins for Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.