Recombinant Rhizobium sp. Exopolysaccharide production protein ExoY(exoY)

Code CSB-CF318483RKX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P14186
Storage Buffer Tris-based buffer,50% glycerol
Species Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Sequence MKSATRSATTAFFIPQETGAIRPIGGISKRSFDVLIAILALIALSPLFLLVMGLVKFSDG GSIFYGHRRIGHNGQTFKCLKFRTMMENGDRVLQEFFKSNPAAYEEWRTTRKLQDDPRVT VVGSVLRKLSLDELPQLLNIIRGEMSIVGPRPVVEDELELYDSAAEFYLRSRPGLTGLWQ ISGRNDVSYATRVAFDTHYVQNWSLLADLVIVFKTIPAVCLSRGSY
Source in vitro E.coli expression system
Gene Names exoY
Protein Names Recommended name: Exopolysaccharide production protein ExoY
Expression Region 1-226
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Needed for the addition of the first sugar (galactose) to the isoprenoid carrier. May function as a sugar transferase.
Subcellular Location Cell membrane, Single-pass membrane protein
Protein Families Bacterial sugar transferase family
Database Links

KEGG: rhi:NGR_b18270

Related Products

exoY Proteins

exoY Proteins for Sinorhizobium fredii (strain NBRC 101917 / NGR234)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.