Recombinant Rhodobacter capsulatus Cytochrome c1(petC)

Code CSB-CF006327RLD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. D5ANZ4
Storage Buffer Tris-based buffer,50% glycerol
Species Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Sequence NSNVPDHAFSFEGIFGKYDQAQLRRGFQVYNEVCSACHGMKFVPIRTLADDGGPQLDPTF VREYAAGLDTIIDKDSGEERDRKETDMFPTRVGDGMGPDLSVMAKARAGFSGPAGSGMNQ LFKGMGGPEYIYNYVIGFEENPECAPEGIDGYYYNKTFQIGGVPDTCKDAAGVKITHGSW ARMPPPLVDDQVTYEDGTPATVDQMAQDVSAFLMWAAEPKLVARKQMGLVAMVMLGLLSV MLYLTNKRLWAPYKGHKA
Source in vitro E.coli expression system
Gene Names petC
Protein Names Recommended name: Cytochrome c1
Expression Region 22-279
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis. c1 functions as an electron donor to cytochrome c.
Subcellular Location Cell membrane, Single-pass membrane protein
Database Links

KEGG: rcp:RCAP_rcc02770

STRING: 272942.RCAP_rcc02770

Related Products

petC Proteins

petC Proteins for Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.