Recombinant Rhodobacter sphaeroides ATP synthase subunit c 2(atpE2)

Code CSB-CF388445RIJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A3PS63
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Sequence MTPETVQIASILGAAFAVGIGSLGPALGEGRAVAAAMEAIARQPEAAGTLSRTLFVGLAM IETMAIYCLVIALLLLFANPFTG
Source in vitro E.coli expression system
Gene Names atpE2
Protein Names Recommended name: ATP synthase subunit c 2 Alternative name(s): ATP synthase F(0) sector subunit c 2 F-type ATPase subunit c 2 Short name= F-ATPase subunit c 2 Lipid-binding protein 2
Expression Region 1-83
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ATPase C chain family
Database Links

KEGG: rsh:Rsph17029_4101

Related Products

atpE2 Proteins

atpE2 Proteins for Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.