Recombinant Rhodobacter sphaeroides CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA)

Code CSB-CF663097RLF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3IYX7
Storage Buffer Tris-based buffer,50% glycerol
Species Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Sequence MNWSIPNILTVLRLLAAPGVAVMFLYFHRPWADWFALTLFILAAVTDFFDGYLARLWKQE SKFGAMLDPIADKAMVVIALVIITGYSGMNPWLILPVTLILFREVFVSGLREFLGAKASL LKVTKLAKWKTTAQMVAIAILFLGTGLEHLEGIARQGMTWEQYARAVSAGEADPIRSCGM HGCSSYATWLGLALIWIAAALTFITGWDYFRKALPYLKDEK
Source in vitro E.coli expression system
Gene Names pgsA
Protein Names Recommended name: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase EC= 2.7.8.5 Alternative name(s): Phosphatidylglycerophosphate synthase Short name= PGP synthase
Expression Region 1-221
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This protein catalyzes the committed step to the synthesis of the acidic phospholipids.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families CDP-alcohol phosphatidyltransferase class-I family
Database Links

KEGG: rsp:RSP_1073

STRING: 272943.RSP_1073

Related Products

pgsA Proteins

pgsA Proteins for Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.