Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF636490RAAJ |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q21WN9 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) (Albidiferax ferrireducens) |
| Sequence | MTKPISLSNRALYARLLSYVRPYWKAVFLAVIGMVGTAATEPVFPAIMKYLLDNGFQAKD ARMVWLIPMGIVTLFLVRSVIVYCTGYLMTWISSRLVTDLRRTMFAKLLALPTHHYDEHS AGQMISRLVYDVSNVTDAATSALITLVRESLTAIALIGYLLYLDWKLTLITLAIGPVIAF TVKSFSKRMRAASQKSLQAMRFISHTIEETISAQQVVKIFGGQERQQKQFFEATEQFRRA QMREAIPASAMTPITHIAASVAVAIIAFLALSQSTGQAGASAGSFISFITAMLMLISPVK QLATVNPTIQRGLAASESIFELLDAAQEDDRGKRQLLRSKGEICFDNVSLRYLGAERFAL NDISFRITAGQTVALVGASGGGKSTISALIPRFYPVTSGRVLVDGIDINDITLASLRQNI ALVSQNVILFNDTVGANIAYGSLQTCSRDDVIRAARAANAWDFIEQLPNGLDTPIGENGA KLSGGQRQRLAIARALLKDAPILILDEATSALDTESERQVQAALAVLMKNRTTLVIAHRL STIEHADCILVLDQGRIVETGTHAELLRAGSYYANLSRLQG |
| Source | in vitro E.coli expression system |
| Gene Names | msbA |
| Protein Names | Recommended name: Lipid A export ATP-binding/permease protein MsbA EC= 3.6.3.- |
| Expression Region | 1-581 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Involved in lipid A export and possibly also in glycerophospholipid export and for biogenesis of the outer membrane. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation. |
| Subcellular Location | Cell inner membrane, Multi-pass membrane protein |
| Protein Families | ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family |
| Database Links |
KEGG: rfr:Rfer_2090 STRING: 338969.Rfer_2090 |
msbA Proteins for Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) (Albidiferax ferrireducens)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP636490RAAJ1 CSB-EP636490RAAJ1 CSB-BP636490RAAJ1 CSB-MP636490RAAJ1 |
Recombinant Rhodoferax ferrireducens Lipid A export ATP-binding/permease protein MsbA(msbA) ,partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2(clpP2)
Express system: E.coli
Species: Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Recombinant Mouse Proprotein convertase subtilisin/kexin type 5(Pcsk5),partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Keratin, type II cytoskeletal 4(KRT4)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Insulin-like growth factor-binding protein 1(Igfbp1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human T-lymphocyte activation antigen CD80(CD80)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Recombinant Human GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1(ART1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Bovine Pulmonary surfactant-associated protein B(SFTPB),Partial
Express system: E.coli
Species: Bos taurus (Bovine)
