Recombinant Rhodospirillum rubrum ATP synthase subunit a(atpB)

Code CSB-CF647778RMB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2RPA4
Storage Buffer Tris-based buffer,50% glycerol
Species Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
Sequence MHSPVEQFAIKPLVSIQVAGVDVSFTNSSLLMLLTVGLAAAFFWNATARRTLIPGRLQSA AEMLYEFVANMIRDNVGKEGMKYFPYILTLFVFVFLGNMLGMLPYSFTFTSHIAVTAALA VGIFIAVTIIGFARHGFHYFRMFFPHGAPLLTAPLLIPIELISYLSRPFSLSVRLFANMT VGHIMLKVLAGFVIMLGVVGGVVPFAVVLGVTVLEFFIAALQAYVFTILTCIYLNDAINM H
Source in vitro E.coli expression system
Gene Names atpB
Protein Names Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6
Expression Region 1-241
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ATPase A chain family
Database Links

KEGG: rru:Rru_A3246

STRING: 269796.Rru_A3246

Related Products

atpB Proteins

atpB Proteins for Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.