Recombinant Rickettsia bellii Putative sensor histidine kinase ntrY-like(RBE_0470)

Code CSB-CF636219RAAI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q1RJB3
Storage Buffer Tris-based buffer,50% glycerol
Species Rickettsia bellii (strain RML369-C)
Sequence MPKLKIFLFKYLYSKRFIGILVAIAIIFSYFTYYTISIGTKNGAVNSSKVIWFLLIDLII FLVLGILLTRKFFQSFFFKNSDQNTSKLQNRIVVAFSLAAAIPTIIVSISSAYFLNLSIQ AWFDRKISVVLDQSIMVADSYIAEHKVLLRETALAVAEDLSDMYYDLIHNPALFTKTLNT EAEMRSLDEAIVLNKSTNTIIANSYLSFSLSFATIPAHLIKKADSCEPVEVKSDPTKIRM LIKLKEYNDVYLLVGRSIDNKIIDHIDATNGAAAEYHRLKNQIGNIQIKFSIIFIFIALL LLLIAISFGVIVTAKIVNPIKKLVIATDKVKSGDLTVQVPENEVDKDEIGTLYAAFNRMI KQLSRQQRDLVIAQRALAWSDVAKKVAHEIKNPLTPILLASERLLKKFSPEIKERAEFEN YLKMIIRHTNDIKNIVSEFVLFARLPAPKFTNCDLIYVINNIVEARKLLNNNILYSFETN IDQFDFTCDTTQINQVMINLLKNAEESLEGSNQAAIKVNINTSEQFINITVLDNGRGFPP ELIGKATESYVTTRSKGMGVGLAIVKRIVEEHCGVLDIANRETGGAVIDIRFNLEELKLK VKRHEIGVIS
Source in vitro E.coli expression system
Gene Names RBE_0470
Protein Names Recommended name: Putative sensor histidine kinase ntrY-like EC= 2.7.13.3
Expression Region 1-610
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Member of the two-component regulatory system RBE_0470/RBE_0312.
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: rbe:RBE_0470

Related Products

RBE_0470 Proteins

RBE_0470 Proteins for Rickettsia bellii (strain RML369-C)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.