Recombinant Rickettsia bellii Uncharacterized protein RBE_1264(RBE_1264)

Code CSB-CF635157RAAI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q1RH19
Storage Buffer Tris-based buffer,50% glycerol
Species Rickettsia bellii (strain RML369-C)
Sequence GFGDSCASLPTTTDGYLESDTAYGYIIRSIDMKAPGGNCDANKPGITFCFKNKDGSSDPC TMYTLNQGDSKKISDLSKDNNPDLGANPILKNIVLTVQTWQNDICLLMPTSRGPMPVACK ALSNPPAPPSVPSCSNIGQSCYTGANYSQSLINFSGLAVQCLKETLDKIFFVGNSCGSQS QSSEITNLTAFPTFQGYLKNAIGAALILYVMFFAFNMVLNKEYGNPDKIALFVIKLLFVT YFSIGLGPLNFNSSQPTQENGMLKYGLPLLTGIAPEFAQIIFNAAGSKGLCVFDTSKYQS GYQFYALWDSIDCRIGYYLGLDLLYNIDKNGVLSSFARGDGGNSSGSIPIPNLGNPDKNS PNALTSVGSLRFFTVMFGFFMAGNVIILISGLVFAVIFLSILLYFITHYLVCMITIYVMT YVSPIFIPMMLFNRTKGYFDGWLKVSLSCALQPAVVAGFIALLITMYDSAIFKNCEFLRY DYEKNNVKFSTFELRLPASSAEVCQESFGYKMLNYYAGKGWEEHLVILFPIKSIAKDVVS ILAELLCVLVFSVIFYYFSKSISQFAADLTNGPKMDAVTASPTKIVDLVKQGAAFIKDAA QATQGKPPSSGDMPGDGGSKRSEGQKGDDSFISSGGNSSGDSLSSSGGK
Source in vitro E.coli expression system
Gene Names RBE_1264
Protein Names Recommended name: Uncharacterized protein RBE_1264
Expression Region 25-673
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families TrbL/VirB6 family
Database Links

KEGG: rbe:RBE_1264

Related Products

RBE_1264 Proteins

RBE_1264 Proteins for Rickettsia bellii (strain RML369-C)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.