Recombinant Rickettsia conorii Putative sensor histidine kinase ntrY-like(RC0948)

Code CSB-CF846185RMS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q92H24
Storage Buffer Tris-based buffer,50% glycerol
Species Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Sequence MLSYLKQNLHSYFSSRVLIFTLATAAIIFACATFYVISLESKNFSTIIGFLLVDLAIFLI LGVVLTQKFFTKNNNNDSSKLQNRIVIAFSLVAAIPTIIVSVFSVYFFNLSVQAWFDKKI STVLDQSVIVAESYIAEHKLQLKETALAVAEDLSDMYYDLIHNPALFTKTLNTEAEMRSL DEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGELVEVKSDPTKIRMLIKLKEY NDVYLLVGRLVDNKIIDHVDATNGAAAEYNSLKNEIDNIQIKFSIMFIFIALLLLFVAIS FGVIFTAKIVKPIKKLVTATDNVKDGDLTVQVPENEVDKDEIGTLYVAFNRMIKQLSRQQ RDLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSPEIKERVEFENYLKMIIR HTNDIKNIVSEFVLFARLPAPKFTKSELVYLVKHIVEARKLLNDHILYKFESNVEQFDFM CDATQINQVMINLLKNAEESIEGRESGKIEVTIDVKDDFISVIVTDNGKGFPPELIGKAT ESYVTTSSKGMGVGLAIVKRIVEEHCGILDIANREAEGAIIDIKFDLKELDLKAKRLEM
Source in vitro E.coli expression system
Gene Names RC0948
Protein Names Recommended name: Putative sensor histidine kinase ntrY-like EC= 2.7.13.3
Expression Region 1-599
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Member of the two-component regulatory system RC0948/RC0849.
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: rco:RC0948

Related Products

RC0948 Proteins

RC0948 Proteins for Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.