Recombinant Rickettsia felis Uncharacterized protein RF_0090(RF_0090)

Code CSB-CF681111RMT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q4UNB7
Storage Buffer Tris-based buffer,50% glycerol
Species Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Sequence GFGESCSSLPTTSDGYLETDTAYGYIIRNIDMKDPRGNCNSAASSITFCFKNIEGSSSPC TIYNLNEGDSKKISDLSTDNNPDLGANPVLKDIVLTVKKWDNDLCLVMPTSRGPMPVACK SLSATPTPTPPDDENCNIGKSCYTGANYSQSLINFSGLAVQCLSETLNKVFFAGNSCSSQ DQNSRITNLAAFSTFQGYLKRIIGAALILYTMFFAFNMALNKEYASTEKIALFVIKFLLV AYFSIGLGPLDFSGGQPTKENGMLKYGLPLLTGAAPDFAQMIFNAAGSRGLCQFDNSKYK DGYKFYGLWDAIDCRIGYYLGLDLLYNIDKNGVLGNSIGNGPGGNNTPIPNFDPDGKKDR PKDLSKAGALRFFAVMFGFFMAGNVIILAAGLVFSVIFLSILLYFITHYLVCMITIYVMT YISPIFIPMALFTRTKAYFDGWLKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRY DYEKGDIRFSTFELRLPNGGADKCQESFGYKMLQYYAGEGWEEHLLILFPIKSIVKDVVS ILAELLCVLVFSVIFYYFSKSIGRFASDLTNGPNMDAVTASPTKIVDLVKKGAAFLKDAA MASQGKPSVGDKPDVGGKRKEGEQQGGDSESGAGGGLADLASGSGGGK
Source in vitro E.coli expression system
Gene Names RF_0090
Protein Names Recommended name: Uncharacterized protein RF_0090
Expression Region 25-672
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families TrbL/VirB6 family
Database Links

KEGG: rfe:RF_0090

STRING: 315456.RF_0090

Related Products

RF_0090 Proteins

RF_0090 Proteins for Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.