Recombinant Rutilus rutilus Opsin-VA

Code CSB-CF759703RIB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7T3Q7
Storage Buffer Tris-based buffer,50% glycerol
Species Rutilus rutilus (Roach)
Sequence MELFPVAVNGVSHAEDPFSGPLTFIAPWNYKVLATLMFVVTAASLSENFAVMLVTFRFTQ LRKPLNYIIVNLSLADFLVSLTGGTISFLTNYHGYFFLGKWACVLEGFAVTYFGIVALWS LAVLAFERFFVICRPLGNIRLRGKHAALGLLFVWTFSFIWTIPPVLGWSSYTVSKIGTTC EPNWYSGNFHDHTFIIAFFITCFILPLGVIVVCYCKLIKKLRKVSNTHGRLGNARKPERQ VTRMVVVMIVAFMVAWTPYAAFSIVVTAHPSIHLDPRLAAAPAFFSKTAAVYNPVIYVFM NKQFRKCLVQLLRCRDVTIIEGNINQTSERQGMTNESHTGEMSTIASRIPKDGSIPEKTQ EHPGERRSLAHIPIPENKVCPM
Source in vitro E.coli expression system
Protein Names Recommended name: Opsin-VA Alternative name(s): Vertebrate ancient opsin
Expression Region 1-382
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Expressed in a subset of retinal horizontal cells as well as in retinal ganglion cells.

Related Products

Proteins

Proteins for Rutilus rutilus (Roach)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.