Recombinant Salmonella agona Potassium-transporting ATPase C chain(kdpC)

Code CSB-CF470827SWK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B5EZE2
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Salmonella agona (strain SL483)
Sequence MIGLRPAFSTMLFLLLLTGGVYPLLTTALGQWWFPWQANGSLIHKDNVIRGSALIGQSFT AAGYFHGRPSATADTPYNPLASGGSNLAASNPELDAQIQARVAALRAANPQASSAVPVEL ATASASGLDNNLTPGAAAWQIPRVAAARQLPVEQVAQLVAEYTHRPLARFLGQPVVNIVE LNLALDALQGHRAK
Source in vitro E.coli expression system
Gene Names kdpC
Protein Names Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain
Expression Region 1-194
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex.
Subcellular Location Cell inner membrane, Single-pass membrane protein
Protein Families KdpC family
Database Links

KEGG: sea:SeAg_B0752

Related Products

kdpC Proteins

kdpC Proteins for Salmonella agona (strain SL483)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.