Recombinant Salmonella choleraesuis Putative 2-aminoethylphosphonate transport system permease protein phnV(phnV)

Code CSB-CF688195SBF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q57SD8
Storage Buffer Tris-based buffer,50% glycerol
Species Salmonella choleraesuis (strain SC-B67)
Sequence MPIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILPSGFTLNHFVNALHGA AWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI LVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISADIENVASSLGASPWYRL RHVTLPLLMPWMMSALALSLSLSMGELGATMMIYPPGWTTLPVAIFSLTDRGNIADGAAL TIVLVAITLLLMMKLERIAKWLGQK
Source in vitro E.coli expression system
Gene Names phnV
Protein Names Recommended name: Putative 2-aminoethylphosphonate transport system permease protein phnV
Expression Region 1-265
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probably part of the PhnSTUV complex (TC 3.A.1.11.5) involved in 2-aminoethylphosphonate import. Probably responsible for the translocation of the substrate across the membrane (By similarity).
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Binding-protein-dependent transport system permease family
Database Links

KEGG: sec:SCH_0467

Related Products

phnV Proteins

phnV Proteins for Salmonella choleraesuis (strain SC-B67)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.