Recombinant Salmonella dublin Potassium-transporting ATPase C chain(kdpC)

Code CSB-CF477407SWN
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B5FND9
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Salmonella dublin (strain CT_02021853)
Sequence MIGLRPAFSTMLFLLLLTGGVYPLLTTALGQWWFPWQANGSLIHKDNVIRGSALIGQSFT AAGYFHGRPSATADTPYNPLASGGSNLAASNPELDAQIQSRVAALRAANPQASSAVPVEL ATASASGLDNNLTPGAAAWQIPRVAAARQLPVEQVAQLVAEYTHRPLARFLGQPVVNIVE LNLALDALQGHRAK
Source in vitro E.coli expression system
Gene Names kdpC
Protein Names Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain
Expression Region 1-194
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex.
Subcellular Location Cell inner membrane, Single-pass membrane protein
Protein Families KdpC family
Database Links

KEGG: sed:SeD_A0812

Related Products

kdpC Proteins

kdpC Proteins for Salmonella dublin (strain CT_02021853)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.