Recombinant Salmonella paratyphi A Rhomboid protease glpG(glpG)

Code CSB-CF712697SBM
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5PLZ8
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Sequence MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVVVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAS WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Source in vitro E.coli expression system
Gene Names glpG
Protein Names Recommended name: Rhomboid protease glpG EC= 3.4.21.105 Alternative name(s): Intramembrane serine protease
Expression Region 1-276
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Peptidase S54 family
Database Links

KEGG: spt:SPA3382

Related Products

glpG Proteins

glpG Proteins for Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.