Recombinant Salmonella paratyphi A Rhomboid protease glpG(glpG)

Code CSB-CF712697SBM
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5PLZ8
Storage Buffer Tris-based buffer,50% glycerol
Species Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Sequence MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVVVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAS WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Source in vitro E.coli expression system
Gene Names glpG
Protein Names Recommended name: Rhomboid protease glpG EC= 3.4.21.105 Alternative name(s): Intramembrane serine protease
Expression Region 1-276
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Peptidase S54 family
Database Links

KEGG: spt:SPA3382

Related Products

glpG Proteins

glpG Proteins for Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.