Recombinant Salmonella typhimurium Undecaprenyl-phosphate galactose phosphotransferase(rfbP)

Code CSB-CF333161SXB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P26406
Storage Buffer Tris-based buffer,50% glycerol
Species Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Sequence MDNIDNKYNPQLCKIFLAISDLIFFNLALWFSLGCVYFIFDQVQRFIPQDQLDTRVITHF ILSVVCVGWFWIRLRHYTYRKPFWYELKEIFRTIVIFAIFDLALIAFTKWQFSRYVWVFC WTFALILVPFFRALTKHLLNKLGIWKKKTIILGSGQNARGAYSALQSEEMMGFDVIAFFD TDASDAEINMLPVIKDTEIIWDLNRTGDVHYILAYEYTELEKTHFWLRELSKHHCRSVTV VPSFRGLPLYNTDMSFIFSHEVMLLRIQNNLAKRSSRFLKRTFDIVCSIMILIIASPLMI YLWYKVTRDGGPAIYGHQRVGRHGKLFPCYKFRSMVMNSQEVLKELLANDPIARAEWEKD FKLKNDPRITAVGRFIRKTSLDELPQLFNVLKGDMSLVGPRPIVSDELERYCDDVDYYLM AKPGMTGLWQVSGRNDVDYDTRVYFDSWYVKNWTLWNDIAILFKTAKVVLRRDGAY
Source in vitro E.coli expression system
Gene Names rfbP
Protein Names Recommended name: Undecaprenyl-phosphate galactose phosphotransferase EC= 2.7.8.6 Alternative name(s): Galactosyl-P-P-undecaprenol synthase
Expression Region 1-476
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Is responsible for transferring galactose-1-phosphate to the lipid precursor undecaprenol phosphate in the first steps of O-polysaccharide biosynthesis.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Bacterial sugar transferase family
Database Links

KEGG: stm:STM2082

STRING: 99287.STM2082

Related Products

rfbP Proteins

rfbP Proteins for Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.