Recombinant Schizosaccharomyces pombe Fe(2+)/Mn(2+) transporter pcl1(pcl1)

Code CSB-CF889213SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9P6J2
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MWSIFEARPKEAHSVNKIGWLRASVLGANDGILSLSGLLVGVVAANADIKVILITGVAGL MSGALSMAVGEYVSVSSQADLEDADLQLERREMDADWDAEVDELAAIYRGRGLDEELSRT VAVQLMEYNALEAHARDELGINIHTTAKPTLAALSSAASFSVGGIFPLLTSLITPLEYLS LVLPIATMFFLGMLGFVGAHIGGAKRVRAILRAVVLGLLAMAATALVGRLLEIHALSLQY AI
Source in vitro E.coli expression system
Gene Names pcl1
Protein Names Recommended name: Fe(2+)/Mn(2+) transporter pcl1 Alternative name(s): Pombe ccc1-like protein 1
Expression Region 1-242
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has a role in both calcium and manganese homeostasis. Involved in the transfer of iron and Mn(2+) from the cytosol to the vacuole for storage of these metals (By similarity).
Subcellular Location Endoplasmic reticulum, Golgi apparatus membrane, Vacuole membrane, Multi-pass membrane protein
Protein Families CCC1 family
Database Links

KEGG: spo:SPBC1683.10c

STRING: 4896.SPBC1683.10c.1

Related Products

pcl1 Antibodies

pcl1 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

pcl1 Proteins

pcl1 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.