Recombinant Sensor protein lytS(lytS)

Code CSB-CF809736SMH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8E7H4
Storage Buffer Tris-based buffer,50% glycerol
Species Streptococcus agalactiae serotype III (strain NEM316)
Sequence MLMVLLFQRLGIIMILAFLLVNNSYFRQLIEERSKRETVVLVIIFGLFVIISNITGIEIK GDRSLVERPFLTTISHSDSLANTRTLVITTASLVGGPLVGSIVGFIGGVHRFFQGSFSGS FYIVSSVLVGIVSGKIGDKLKENHLYPSTSQVILISIIAESIQMLFVGIFTGWELVKMIV IPMMILNSLGSTLFLAILKTYLSNESQLRAVQTRDVLELTRQTLPYLRQGLTPQSARSVC EIIKRHTNFDAVGLTDRSNVLAHIGVGHDHHIAGQPVKTDLSKSVIFDGEPRIAQDKAAI SCPDHNCQLNSAIVVPLKINDKTVGALKMYFAGDKTMSEVEENLVLGLAQIFSGQLAMGI TEEQNKLASMAEIKALQAQINPHFFFNAINTISALIRIDSDKARYALMQLSTFFRTSLQG GQDREVTLEQEKSHVDAYMNVEKLRFPDKYQLSYDISAPEKMKLPPFGLQVLVENAVRHA FKERKTDNHILVQIKPDGHYYCVSVSDNGQGISDTIIDKLGQETVAESKGTGTALVNLNN RLNLLYGSVSCLHFSSDKNGTKVWYRIPNRIREDEHENFNS
Source in vitro E.coli expression system
Gene Names lytS
Protein Names Recommended name: Sensor protein lytS EC= 2.7.13.3
Expression Region 1-581
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Member of the two-component regulatory system LytR/LytS that probably regulates genes involved in cell wall metabolism.
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: san:gbs0180

Related Products

lytS Proteins

lytS Proteins for Streptococcus agalactiae serotype III (strain NEM316)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.