Recombinant Sensor protein lytS(lytS)

Code CSB-CF817634SMI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8E218
Storage Buffer Tris-based buffer,50% glycerol
Species Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Sequence MLMVLLFQRLGIIMILAFLLVNNSYFRQLIEERSKRETVVLVIIFGLFVIISNITGIEIK GDRSLVERPFLTTISHSDSLANTRTLVITTASLVGGPLVGSIVGFIGGVHRFFQGSFSGS FYIVSSVLVGIVSGKIGDKLKENHLYPSTSQVILISIIAESIQMLFVGIFTGWELVKMIV IPMMILNSLGSTLFLAILKTYLSNESQLRAVQTRDVLELTRQTLPYLRQGLTPQSARSVC EIIKRHTNFDAVGLTDRSNVLAHIGVGHDHHIAGQPVKTDLSKSVIFDGEPRIAQDKAAI SCPDHNCQLNSAIVVPLKINDKTVGALKMYFAGDKTMSEVEENLVLGLAQIFSGQLAMGI TEEQNKLASMAEIKALQAQINPHFFFNAINTISALIRIDSDKARYALMQLSTFFRTSLQG GQDREVTLEQEKSHVDAYMNVEKLRFPDKYQLSYDISAPEKMKLPPFGLQVLVENAVRHA FKERKTDNHILVQIKPDGHYYCVSVSDNGQGISDTIIDKLGQETVAESKGTGTALVNLNN RLNLLYGSVSCLHFSSDKNGTKVWYRIPNRIREDEHENFNS
Source in vitro E.coli expression system
Gene Names lytS
Protein Names Recommended name: Sensor protein lytS EC= 2.7.13.3
Expression Region 1-581
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Member of the two-component regulatory system LytR/LytS that probably regulates genes involved in cell wall metabolism.
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: sag:SAG0182

Related Products

lytS Proteins

lytS Proteins for Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.