Recombinant Sheep Amiloride-sensitive sodium channel subunit beta(SCNN1B)

Code CSB-CF020849SH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O62816
Storage Buffer Tris-based buffer,50% glycerol
Species Ovis aries (Sheep)
Sequence MHLKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFVLTLLFT SLVCWQWGLFIKTYLNWEVSVSLSIGFKTMDFPAVTICNASPFQYSKVQHLLKDLDALME AVLGRILGPELSQVNATTALNLSIWHHTPLVFINEQNPHHPVVLDLFEDNFNGSASSSPA PGRPCSARRCKVAMRLCSHNGTTCTFRNFSSATQAVTEWYTLQATNIFAQVPNQELVAMG YPAERLILACLFGAEPCNYRNFTPIFHPDYGNCYIFNWGMTEKALPSANPGTEFGLKLIL DMGQEDYVPFLTSTAGARLMLHEQRSYPFIKEEGIYAMAGMETSIGVLVDKLQRKGEPYS QCTKNGSDVPIQNLYSSYNTTYSIQACIRSCFQEHMIRECGCGHYLYPLPDKRKYCNNQE FPDWAHCYSALRISMAQRETCIYACKESCKLLGTSPPLPPCLLPPVSPQDWIFHVLSQER DQSSNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIE FGEIIIDFVWITIIKLVALAKSVRGPPPTVAELVEAHTNFGFQPDSAMPGPDAGAYRREQ NPPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
Source in vitro E.coli expression system
Gene Names SCNN1B
Protein Names Recommended name: Amiloride-sensitive sodium channel subunit beta Alternative name(s): Beta-NaCH Epithelial Na(+) channel subunit beta Short name= Beta-ENaC Nonvoltage-gated sodium channel 1 subunit beta SCNEB
Expression Region 1-632
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
Subcellular Location Apical cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane
Protein Families Amiloride-sensitive sodium channel (TC 1.A.6) family, SCNN1B subfamily
Database Links

UniGene: Oar.614

Related Products

SCNN1B Proteins

SCNN1B Proteins for Ovis aries (Sheep)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.