Recombinant Sheep Corticosteroid 11-beta-dehydrogenase isozyme 1(HSD11B1)

Code CSB-CF010763SH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P51975
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Ovis aries (Sheep)
Sequence AFMKKYLLPILGIFLAYYYYSANEEFRPEMLRGKRVIVTGASKGIGREMAYHLARMGAHVVVTARSEESLKKVVSRCLELGAASAHYVAGTMENMTFAEQFVAKAGELVGGLDMLILNHINYTPLRVFSNDIHLLRRSLEVNLLSYVVLSTAALPMLKQTSGSIVVVSSVAGKIACPLAAAYSASKFALDGFFSSLRTEYEATKVNVSITLCILGLIDTDTAMKAVAGIYNAEASPKEECALEIIKGGALRQDEVYYDNSILTSLLLKNPGRKIMEFLSLKKYNMERFINN
Source in vitro E.coli expression system
Gene Names HSD11B1
Protein Names Recommended name: Corticosteroid 11-beta-dehydrogenase isozyme 1 EC= 1.1.1.146 Alternative name(s): 11-beta-hydroxysteroid dehydrogenase 1 Short name= 11-DH Short name= 11-beta-HSD1
Expression Region 2-292
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes reversibly the conversion of corticosterone to 11-dehydrocorticosterone.
Subcellular Location Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity Liver, kidney, lung, hypothalamus, anterior pituitary and placenta.
Database Links

KEGG: oas:443409

UniGene: Oar.418

Related Products

HSD11B1 Proteins

HSD11B1 Proteins for Ovis aries (Sheep)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.