Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF2(ORF2)

Code CSB-CF773303SGAH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q88427
Storage Buffer Tris-based buffer,50% glycerol
Species Spiroplasma virus SpV1-C74 (SpV1)
Sequence MKKFIFFFKNYCYISGSMLLFSLIDLLLWIISLYCVGLVFWILFALQCVYFVWWLWKNIF YQLNAFRLVNFVWDNPLSVIIGKLGTGKTLLLTYLSQTMKLLTDEIYSNYPLEDDKVKVL TFKNLDFTDRTKPVPPDDSVILFDESYLYIDGTSPHDEKKVHSGKIPWIVLARHFRHRAL FTAQREGMIWNNIRQLASGIIIPISLKKPVAKKGFNFFNRFFIMRMGIFQDITDYEIWKT KSVERTAEGKRAKHKSDVGLGIRFFKIIIPLEFANKYDSEWLKFVRDLKNDEIVNEKFYY WSEITKLSVKERLELFDIDILKKNLKPRKEKGNGKDD
Source in vitro E.coli expression system
Gene Names ORF2
Protein Names Recommended name: Uncharacterized protein ORF2
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Host membrane, Multi-pass membrane protein
Protein Families Plectrovirus ORF2 family
Database Links

KEGG: vg:944350

Related Products

ORF2 Proteins

ORF2 Proteins for Spiroplasma virus SpV1-C74 (SpV1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.