Recombinant Staphylococcus aureus Monofunctional glycosyltransferase(mgt)

Code CSB-CF751953SKY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7A4S6
Storage Buffer Tris-based buffer,50% glycerol
Species Staphylococcus aureus (strain N315)
Sequence MKRSDRYSNSNEHFEHMKHEPHYNTYYQPVGKPPKKKKSKRILLKILLTILIIIALFIGI MYFLSTRDNVDELRKIENKSSFVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALF STISDRDVQGGSTITQQVVKNYFYDNDRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNI YFGDNQYTLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKVNAPSVYNINNMSENFTQ RVSTNLEKMKQQNYINETQYQQAMSQLNR
Source in vitro E.coli expression system
Gene Names mgt
Protein Names Recommended name: Monofunctional glycosyltransferase Short name= MGT EC= 2.4.-.- Alternative name(s): Peptidoglycan TGase
Expression Region 1-269
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Peptidoglycan polymerase that catalyzes glycan chain elongation using lipid-linked disaccharide-pentapeptide as the substrate.
Subcellular Location Cell membrane, Single-pass membrane protein
Protein Families Glycosyltransferase 51 family
Database Links

KEGG: sau:SA1691

Related Products

mgt Proteins

mgt Proteins for Staphylococcus aureus (strain N315)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.