Recombinant Staphylococcus aureus Putative multidrug export ATP-binding/permease protein SA1683(SA1683)

Code CSB-CF758925SKY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7A4T3
Storage Buffer Tris-based buffer,50% glycerol
Species Staphylococcus aureus (strain N315)
Sequence MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL
Source in vitro E.coli expression system
Gene Names SA1683
Protein Names Recommended name: Putative multidrug export ATP-binding/permease protein SA1683 EC= 3.6.3.-
Expression Region 1-578
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in multidrug export. Transmembrane domains (TMD) form a pore in the cell membrane and the ATP-binding domain (NBD) is responsible for energy generation (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily
Database Links

KEGG: sau:SA1683

Related Products

SA1683 Proteins

SA1683 Proteins for Staphylococcus aureus (strain N315)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.