Recombinant Staphylococcus aureus Putative multidrug export ATP-binding/permease protein SAOUHSC_02003(SAOUHSC_02003)

Code CSB-CF639332FLF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2G2M9
Storage Buffer Tris-based buffer,50% glycerol
Species Staphylococcus aureus (strain NCTC 8325)
Sequence MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL
Source in vitro E.coli expression system
Gene Names SAOUHSC_02003
Protein Names Recommended name: Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 EC= 3.6.3.-
Expression Region 1-578
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in multidrug export. Transmembrane domains (TMD) form a pore in the cell membrane and the ATP-binding domain (NBD) is responsible for energy generation (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily
Database Links

KEGG: sao:SAOUHSC_02003

STRING: 93061.SAOUHSC_02003

Related Products

SAOUHSC_02003 Proteins

SAOUHSC_02003 Proteins for Staphylococcus aureus (strain NCTC 8325)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.