Recombinant Staphylococcus aureus Sensor histidine kinase graS(graS)

Code CSB-CF859209SKX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q99VW1
Storage Buffer Tris-based buffer,50% glycerol
Species Staphylococcus aureus (strain Mu50 / ATCC 700699)
Sequence MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLIL TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDTKWCRMIIRQILSNALK YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF
Source in vitro E.coli expression system
Gene Names graS
Protein Names Recommended name: Sensor histidine kinase graS EC= 2.7.13.3 Alternative name(s): Glycopeptide resistance-associated protein S
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Member of the two-component regulatory system GraR/GraS involved in resistance against cationic antimicrobial peptides (CAMPs). GraS probably functions as a sensor protein kinase which is autophosphorylated at a histidine residue and transfers its phosphate group to GraR. Confers resistance to vancomycin and polymyxin B.
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: sav:SAV0660

STRING: 158878.SAV0660

Related Products

graS Proteins

graS Proteins for Staphylococcus aureus (strain Mu50 / ATCC 700699)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.