Recombinant Staphylococcus aureus UPF0365 protein SaurJH1_1665 (SaurJH1_1665)

Code CSB-CF407712SUI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6U245
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Staphylococcus aureus (strain JH1)
Sequence MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH
Source in vitro E.coli expression system
Gene Names SaurJH1_1665
Protein Names Recommended name: UPF0365 protein SaurJH1_1665
Expression Region 1-329
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0365 family
Database Links

KEGG: sah:SaurJH1_1665

Related Products

SaurJH1_1665 Proteins

SaurJH1_1665 Proteins for Staphylococcus aureus (strain JH1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.