Recombinant Staphylococcus aureus Uncharacterized membrane protein SAOUHSC_00760(SAOUHSC_00760)

Code CSB-CF640238FLF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2G061
Storage Buffer Tris-based buffer,50% glycerol
Species Staphylococcus aureus (strain NCTC 8325)
Sequence MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL
Source in vitro E.coli expression system
Gene Names SAOUHSC_00760
Protein Names Recommended name: Uncharacterized membrane protein SAOUHSC_00760
Expression Region 1-356
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: sao:SAOUHSC_00760

STRING: 93061.SAOUHSC_00760

Related Products

SAOUHSC_00760 Proteins

SAOUHSC_00760 Proteins for Staphylococcus aureus (strain NCTC 8325)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.