Recombinant Streptococcus pneumoniae Glycerol uptake facilitator protein(glpF)

Code CSB-CF358405SMP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0A3Q8
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Sequence MMNELFGEFLGTLILILLGNGVVAGVVLPKTKSNSSGWIVITMGWGIAVAVAVFVSGKLSPAHLNPAVTIGVALKGGLPWASVLPYILAQFAGAMLGQILVWLQFKPHYEAEENAGNILATFSTGPAIKDTVSNLISEILGTFVLVLTIFALGLYDFQAGIGTFAVGTLIVGIGLSLGGTTGYALNPARDLGPRIMHSILPIPNKGDGDWSYAWIPVVGPVIGAALAVLVFSLF
Source in vitro E.coli expression system
Gene Names glpF
Protein Names Recommended name: Glycerol uptake facilitator protein
Expression Region 1-234
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Glycerol enters the cell via the glycerol diffusion facilitator protein. This membrane protein facilitates the movement of glycerol across the cytoplasmic membrane (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family
Database Links

KEGG: spr:spr1988

STRING: 171101.spr1988

Related Products

glpF Proteins

glpF Proteins for Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.