Recombinant Streptococcus pneumoniae Protease HtpX homolog(htpX)

Code CSB-CF506774FMX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. C1C7R3
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Streptococcus pneumoniae (strain 70585)
Sequence MLFDQIASNKRKTWILLLVFFLLLALVGYAVGYLFIRSGLGGLVIALIIGFIYALSMIFQ STEIVMSMNGAREVDEQTAPDLYHVVEDMALVAQIPMPRVFIIDDPALNAFATGSNPQNA AVAATSGLLAIMNREELEAVMGHEVSHIRNYDIRISTIAVALASAITMLSSMAGRMMWWG GAGRRRSDDDRDGNGLEIIMLVVSLLAIVLAPLAATLVQLAISRQREFLADASSVELTRN PQGMINALDKLDNSKPMSRHVDDASSALYINDPKKGGGFQKLFYTHPPISERIERLKHM
Source in vitro E.coli expression system
Gene Names htpX
Protein Names Recommended name: Protease HtpX homolog EC= 3.4.24.-
Expression Region 1-299
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Peptidase M48B family
Database Links

KEGG: snm:SP70585_1348

Related Products

htpX Proteins

htpX Proteins for Streptococcus pneumoniae (strain 70585)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.