Recombinant Suncus murinus Type I iodothyronine deiodinase(DIO1)

Code CSB-CF836109FPS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q95N00
Storage Buffer Tris-based buffer,50% glycerol
Species Suncus murinus (Asian house shrew) (Musk shrew)
Sequence MGLPGLGLLLKRFGVLVRVALKVAVGKVLLTLWPSAIRPHLLAMSEKTGMAKNPRFTYED WAPTFFSTQYFWFVLKVNWQQLEDRTKQGDIAPDSPVVHLSGQRARLWDFMQGNRPLVLN FGSCSUPSFLFKFDQFKRLVEDFSSVADFLTVYIEEAHASDGWAFKNNVDIRRHRDLQER LQAARLLLDRNPGCPVVVDTMENRSSQLYAALPERLYVLQEGRILYKGGPGPWNYHPEEV HAVLEQLCRSSAQSPRL
Source in vitro E.coli expression system
Gene Names DIO1
Protein Names Recommended name: Type I iodothyronine deiodinase EC= 1.97.1.10 Alternative name(s): 5DI DIOI Type 1 DI Type-I 5'-deiodinase
Expression Region 1-257
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine) and of T3 into T2 (3,3'-diiodothyronine).
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families Iodothyronine deiodinase family
Tissue Specificity Liver specific.

Related Products

DIO1 Proteins

DIO1 Proteins for Suncus murinus (Asian house shrew) (Musk shrew)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.