Recombinant Todarodes pacificus Retinochrome

Code CSB-CF328429TFR
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P23820
Storage Buffer Tris-based buffer,50% glycerol
Species Todarodes pacificus (Japanese flying squid) (Ommastrephes pacificus)
Sequence MFGNPAMTGLHQFTMWEHYFTGSIYLVLGCVVFSLCGMCIIFLARQSPKPRRKYAILIHV LITAMAVNGGDPAHASSSIVGRWLYGSVGCQLMGFWGFFGGMSHIWMLFAFAMERYMAVC HREFYQQMPSVYYSIIVGLMYTFGTFWATMPLLGWASYGLEVHGTSCTINYSVSDESYQS YVFFLAIFSFIFPMVSGWYAISKAWSGLSAIPDAEKEKDKDILSEEQLTALAGAFILISL ISWSGFGYVAIYSALTHGGAQLSHLRGHVPPIMSKTGCALFPLLIFLLTARSLPKSDTKK P
Source in vitro E.coli expression system
Protein Names Recommended name: Retinochrome Alternative name(s): Retinal photoisomerase
Expression Region 1-301
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Retinochrome is capable of acting as an effective catalyst in the light to convert various isomers of retinal into 11-cis, the form that is required by opsin to resynthesize rhodopsin.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Mainly stored in myeloid bodies of the inner segments.

Related Products

Proteins

Proteins for Todarodes pacificus (Japanese flying squid) (Ommastrephes pacificus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.