Recombinant Treponema pallidum Uncharacterized protein TP_0473 (TP_0473)

Code CSB-CF530628TPR
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O83486
Storage Buffer Tris-based buffer,50% glycerol
Species Treponema pallidum (strain Nichols)
Sequence MVTVSIVEIFLIISLPLLFFSSFADAGDPLQELISFVHGAVLAVPLLLLRSFFLGYYPPD SALVEEQWMRFFLFDYVFPLFCLPFFLFTSRSLERVSLVSGVSALFGAYTSFFFVHVYTQ LNDPDLLARVMTLVLYMTNLLQLHAHVSFSMRTRLPLLGLIAALCIFLLMGAFSATVMTL CFFNARTVVYTSMLAGAGGVALLTHFFAVRINVR
Source in vitro E.coli expression system
Gene Names TP_0473
Protein Names Recommended name: Uncharacterized protein TP_0473
Expression Region 1-214
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: tpa:TP_0473

STRING: 243276.TP0473

Related Products

TP_0473 Proteins

TP_0473 Proteins for Treponema pallidum (strain Nichols)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.